- Product Code: HOR-235
- Synonyms/Product Alternate Names: Somatoliberin, Growth hormone-releasing factor, GRF, Growth hormone-releasing hormone, GHRH, Somatocrinin, Somatorelin, Sermorelin, GHRF, MGC119781, Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-NH2
Introduction: Growth-hormone-releasing hormone (GHRH), also known as growth-hormone-releasing factor (GRF or GHRF) or somatocrinin, is a 44-amino acidpeptide hormoneproduced in the arcuate nucleusof the hypothalamus.GHRH is released from neurosecretory nerve terminals of these arcuate neurons, and is carried by the hypothalamo-hypophysial portal circulation to the anterior pituitary glandwhere it stimulates growth hormone(GH) secretion. GHRH also stimulates the production of GH. GHRH is released in a pulsatile manner, stimulating similar pulsatile release of GH. In addition, GHRH also promotes slow-wave sleepdirectly.Description: Growth Hormone Releasing Hormone Human Synthetic is a single, non-glycosylated, polypeptide chain containing 29 amino acids and having a molecular mass of 3358.9 Dalton. Corresponds to the amino-terminal segment of the naturally occurring human growth hormone-releasing hormone consisting of 44 amino acid residues.The GHRH is purified by proprietary chromatographic techniques.Physical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.Formulation: The GHRH peptide (1mg/ml) was lyophilized after extensive dialyses against 1.7 mg sodium phosphate buffer (0.1 mg sodium phosphate monobasic & 1.6 mg sodium phosphate dibasic).Solubility: It is recommended to reconstitute the lyophilized GHRH in sterile 18MΩ-cm H2O not less than 100 µg/ml, which can then be further diluted to other aqueous solutions. The GHRH is also soluble in 1% Acetic acid at a concentration of >1mg/ml to give a clear, colorless solution.Stability: Lyophilized Growth Hormone Releasing Hormone although stable at room temperature for 3 weeks, should be stored desiccated below-18°C. Upon reconstitution GHRF should be stored at 4°C between2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.Purity: Greater than 98.0% as determined by:(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE.Biological Activity: GHRH increases plasma growth hormone concentrations by directly stimulating the anterior pituitary gland to release natural human growth hormone.For LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
- Storage Conditions: -20 °C
- Molecular Formula: C149H246N44O42S
- One-Letter Code:YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2
Delivery Details: All quantities are subject to availability. Please allow 7-10 days for delivery.

